C3orf17 Antibody

Name C3orf17 Antibody
Supplier Novus Biologicals
Catalog NBP1-59920
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQINKNSTSGTIK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C3orf17
Conjugate Unconjugated
Supplier Page Shop

Product images