BAT5 Antibody
| Name | BAT5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59409 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Pig, Bovine |
| Antigen | Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the middle region of BAT5. Peptide sequence RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABHD16A |
| Supplier Page | Shop |
Product images
![Western Blot: BAT5 Antibody [NBP1-59409] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13910_BAT5%2520Antibody-Western%2520Blot-NBP1-59409-img0003.jpg)
Western Blot: BAT5 Antibody [NBP1-59409] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.