RAD54B Antibody

Name RAD54B Antibody
Supplier Novus Biologicals
Catalog NBP1-58238
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAD54B(RAD54 homolog B (S. cerevisiae)) The peptide sequence was selected from the N terminal of RAD54B. Peptide sequence RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAD54B
Conjugate Unconjugated
Supplier Page Shop

Product images