NT5C1B Antibody

Name NT5C1B Antibody
Supplier Novus Biologicals
Catalog NBP1-56911
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NT5C1B(5'-nucleotidase, cytosolic IB) The peptide sequence was selected from the N terminal of NT5C1B. Peptide sequence MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NT5C1B
Conjugate Unconjugated
Supplier Page Shop

Product images