Name | NT5C1B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56911 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to NT5C1B(5'-nucleotidase, cytosolic IB) The peptide sequence was selected from the N terminal of NT5C1B. Peptide sequence MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | NT5C1B |
Conjugate | Unconjugated |
Supplier Page | Shop |