C11orf67 Antibody
| Name | C11orf67 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56786 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Pig, Dog |
| Antigen | Synthetic peptides corresponding to C11ORF67 The peptide sequence was selected from the middle region of C11ORF67. Peptide sequence SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AAMDC |
| Supplier Page | Shop |
Product images
![Western Blot: C11orf67 Antibody [NBP1-56786] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13789_C11orf67%2520Antibody-Western%2520Blot-NBP1-56786-img0002.jpg)
Western Blot: C11orf67 Antibody [NBP1-56786] - Human Placenta lysate, concentration 0.2-1 ug/ml.