SOHLH1 Antibody

Name SOHLH1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56762
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the C terminal of SOHLH1. Peptide sequence PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALK
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SOHLH1
Conjugate Unconjugated
Supplier Page Shop

Product images