SPATA2L Antibody

Name SPATA2L Antibody
Supplier Novus Biologicals
Catalog NBP1-56681
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPATA2L(spermatogenesis associated 2-like) The peptide sequence was selected from the middle region of SPATA2L. Peptide sequence SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPATA2L
Conjugate Unconjugated
Supplier Page Shop

Product images