ALAD Antibody
| Name | ALAD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89158 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALAD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ALAD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28857_ALAD-Antibody-Western-Blot-NBP1-89158-img0004.jpg)
Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
![Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28858_ALAD-Antibody-Immunohistochemistry-Paraffin-NBP1-89158-img0007.jpg)
Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.
![Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28859_ALAD-Antibody-Simple-Western-NBP1-89158-img0005.jpg)
Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28860_ALAD-Antibody-Simple-Western-NBP1-89158-img0006.jpg)
Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.