CPXCR1 Antibody
| Name | CPXCR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80386 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human CPXCR1. Peptide sequence WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CPXCR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CPXCR1 Antibody [NBP1-80386] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29759_CPXCR1-Antibody-Western-Blot-NBP1-80386-img0002.jpg)
Western Blot: CPXCR1 Antibody [NBP1-80386] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.
![Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human thymus after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29760_CPXCR1-Antibody-Immunohistochemistry-NBP1-80386-img0003.jpg)
Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human thymus after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.
![Immunohistochemistry-Paraffin: CPXCR1 Antibody [NBP1-80386] - Human Tymus Tissue, 10ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29761_CPXCR1-Antibody-Immunohistochemistry-Paraffin-NBP1-80386-img0001.jpg)
Immunohistochemistry-Paraffin: CPXCR1 Antibody [NBP1-80386] - Human Tymus Tissue, 10ug/ml.
![Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human testis after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29762_CPXCR1%2520Antibody-Immunohistochemistry-NBP1-80386-img0004.jpg)
Immunohistochemistry: CPXCR1 Antibody [NBP1-80386] - Analysis of human testis after heat-induced Antigen retrieval. Antibody concentration 10 ug/ml.