DNAJB5 Antibody

Name DNAJB5 Antibody
Supplier Novus Biologicals
Catalog NBP1-79941
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human DNAJB5The immunogen for this antibody is DNAJB5. Peptide sequence MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DNAJB5
Conjugate Unconjugated
Supplier Page Shop