GABA-A R rho 2 Antibody

Name	GABA-A R rho 2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-80061
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC
Species Reactivities	Human
Antigen	Synthetic peptide directed towards the middle region of human GABRR2 (NP_002034). Peptide sequence SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	GABRR2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane(tight junctions - intercalated disks) Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Human Adult heart Observed Staining: Membrane (tight junctions - intercalated disks) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 s