HIATL1 Antibody

Name HIATL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-79801
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human HIATL1The immunogen for this antibody is HIATL1. Peptide sequence GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HIATL1
Conjugate Unconjugated
Supplier Page Shop

Product images