MICALL1 Antibody

Name MICALL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-79460
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human MICALL1The immunogen for this antibody is MICALL1. Peptide sequence ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MICALL1
Conjugate Unconjugated
Supplier Page Shop

Product images