ECHDC3 Antibody

Name ECHDC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-79302
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Bovine, Dog
Antigen Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene ECHDC3
Supplier Page Shop

Product images