Name | ECHDC3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79302 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Bovine, Dog |
Antigen | Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | ECHDC3 |
Supplier Page | Shop |