WDR89 Antibody

Name WDR89 Antibody
Supplier Novus Biologicals
Catalog NBP1-56333
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR89(WD repeat domain 89) The peptide sequence was selected from the middle region of WDR89. Peptide sequence TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDR89
Conjugate Unconjugated
Supplier Page Shop

Product images