HLA F Antibody
| Name | HLA F Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59537 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HLA-F(major histocompatibility complex, class I, F) The peptide sequence was selected from the N terminal of HLA-F. Peptide sequence EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HLA-F |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HLA F Antibody [NBP1-59537] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24946_HLA-F-Antibody-Western-Blot-NBP1-59537-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: HLA F Antibody [NBP1-59537] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Membrane and cytoplasmic in alveolar type I cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24947_HLA-F-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59537-img0003.jpg)