ChGn Antibody
| Name | ChGn Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59219 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CHGN The peptide sequence was selected from the C terminal of CHGN. Peptide sequence DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CSGALNACT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ChGn Antibody [NBP1-59219] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7345_ChGn-Antibody-Western-Blot-NBP1-59219-img0002.jpg)
![Western Blot: ChGn Antibody [NBP1-59219] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7346_ChGn%2520Antibody-Western%2520Blot-NBP1-59219-img0003.jpg)