Name | Galactosylceramidase/GALC Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62280 |
Prices | $369.00 |
Sizes | 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GALC(galactosylceramidase) The peptide sequence was selected from the middle region of GALC. Peptide sequence LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | GALC |
Conjugate | Unconjugated |
Supplier Page | Shop |