Galactosylceramidase/GALC Antibody

Name Galactosylceramidase/GALC Antibody
Supplier Novus Biologicals
Catalog NBP1-62280
Prices $369.00
Sizes 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GALC(galactosylceramidase) The peptide sequence was selected from the middle region of GALC. Peptide sequence LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GALC
Conjugate Unconjugated
Supplier Page Shop

Product images