Carbohydrate Sulfotransferase 15/CHST15 Antibody
| Name | Carbohydrate Sulfotransferase 15/CHST15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59012 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CHST15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14622_Carbohydrate-Sulfotransferase-15-CHST15-Antibody-Western-Blot-NBP1-59012-img0004.jpg)
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14623_Carbohydrate-Sulfotransferase-15-CHST15-Antibody-Western-Blot-NBP1-59012-img0002.jpg)
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Hela cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14624_Carbohydrate-Sulfotransferase-15-CHST15-Antibody-Western-Blot-NBP1-59012-img0003.jpg)
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - MCF7, Antibody Dilution: 1.0 ug/ml CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14625_Carbohydrate%2520Sulfotransferase%252015-CHST15%2520Antibody-Western%2520Blot-NBP1-59012-img0005.jpg)
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - MCF7, Antibody Dilution: 1.0 ug/ml CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.