RAB38 Antibody
| Name | RAB38 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58930 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB38 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RAB38 Antibody [NBP1-58930] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7450_RAB38-Antibody-Western-Blot-NBP1-58930-img0002.jpg)
![Western Blot: RAB38 Antibody [NBP1-58930] - Human, Mouse.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7451_RAB38%2520Antibody-Western%2520Blot-NBP1-58930-img0003.jpg)