ACTL6B Antibody

Name ACTL6B Antibody
Supplier Novus Biologicals
Catalog NBP1-55478
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTL6B
Conjugate Unconjugated
Supplier Page Shop

Product images