PCMTD1 Antibody

Name PCMTD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54370
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCMTD1(protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1) The peptide sequence was selected from the middle region of PCMTD1. Peptide sequence TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSV
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PCMTD1
Conjugate Unconjugated
Supplier Page Shop

Product images