ECHDC1 Antibody
| Name | ECHDC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53053 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Bovine, Dog, Rabbit |
| Antigen | Synthetic peptides corresponding to ECHDC1(enoyl Coenzyme A hydratase domain containing 1) The peptide sequence was selected from the middle region of ECHDC1. Peptide sequence GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ECHDC1 |
| Supplier Page | Shop |
Product images
![Western Blot: ECHDC1 Antibody [NBP1-53053] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3768_ECHDC1%2520Antibody-Western%2520Blot-NBP1-53053-img0002.jpg)
Western Blot: ECHDC1 Antibody [NBP1-53053] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.