FSTL5 Antibody

Name FSTL5 Antibody
Supplier Novus Biologicals
Catalog NBP1-52853
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FSTL5(follistatin-like 5) The peptide sequence was selected from the middle region of FSTL5. Peptide sequence NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FSTL5
Conjugate Unconjugated
Supplier Page Shop

Product images