Name | LRRC20 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56883 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Bovine, Dog, Goat |
Antigen | Synthetic peptides corresponding to LRRC20(leucine rich repeat containing 20) The peptide sequence was selected from the middle region of LRRC20. Peptide sequence TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LRRC20 |
Supplier Page | Shop |