NEU4 Antibody

Name NEU4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56703
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NEU4(sialidase 4) The peptide sequence was selected from the N terminal of NEU4. Peptide sequence TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NEU4
Conjugate Unconjugated
Supplier Page Shop

Product images