PLAC9 Antibody

Name PLAC9 Antibody
Supplier Novus Biologicals
Catalog NBP1-56571
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PLAC9(placenta-specific 9) The peptide sequence was selected from the middle region of PLAC9. Peptide sequence RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PLAC9
Conjugate Unconjugated
Supplier Page Shop

Product images