RENT1/UPF1/hUPF1 Antibody
| Name | RENT1/UPF1/hUPF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89641 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RENT1/UPF1/hUPF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UPF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28485_RENT1-UPF1-hUPF1-Antibody-Western-Blot-NBP1-89641-img0010.jpg)
Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28486_RENT1-UPF1-hUPF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89641-img0011.jpg)
Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Staining of human duodenum shows strong granular positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28487_RENT1-UPF1-hUPF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89641-img0006.jpg)
Immunohistochemistry-Paraffin: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Staining of human duodenum shows strong granular positivity in glandular cells.
![Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28488_RENT1-UPF1-hUPF1-Antibody-Western-Blot-NBP1-89641-img0009.jpg)
Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in human cell line A-549.