UFL1 Antibody
| Name | UFL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90692 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFSKQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UFL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UFL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UFL1 Antibody [NBP1-90692] - Analysis in human cell line Daudi.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28540_UFL1-Antibody-Western-Blot-NBP1-90692-img0008.jpg)
Western Blot: UFL1 Antibody [NBP1-90692] - Analysis in human cell line Daudi.
![Immunocytochemistry/Immunofluorescence: UFL1 Antibody [NBP1-90692] - Staining of human cell line A-431 shows positivity in nucleus & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28541_UFL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90692-img0006.jpg)
Immunocytochemistry/Immunofluorescence: UFL1 Antibody [NBP1-90692] - Staining of human cell line A-431 shows positivity in nucleus & cytoplasm.
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human urinary bladder shows cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28542_UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0009.jpg)
Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human urinary bladder shows cytoplasmic positivity in urothelial cells.
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28543_UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0002.jpg)
Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.