Argininosuccinate Lyase Antibody
| Name | Argininosuccinate Lyase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87462 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Cat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Argininosuccinate Lyase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADSL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Argininosuccinate Lyase Antibody [NBP1-87462] - Analysis in human cell line HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/20840_Argininosuccinate-Lyase-Antibody-Western-Blot-NBP1-87462-img0006.jpg)
![Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/20841_Argininosuccinate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-87462-img0007.jpg)