Name | mediator of cell motility 1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-88269 |
Prices | $419.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ICC/IF IHC IHC-P |
Species Reactivities | Human, Rat |
Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK |
Purity/Format | Immunogen affinity purified |
Blocking Peptide | mediator of cell motility 1 Recombinant Protein Antigen |
Description | Rabbit Polyclonal |
Gene | MEMO1 |
Conjugate | Unconjugated |
Supplier Page | Shop |