MEF2BNB Antibody
| Name | MEF2BNB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33633 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MEF2BNB Protein |
| Description | Rabbit Polyclonal |
| Gene | MEF2BNB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25176_MEF2BNB-Antibody-Immunohistochemistry-Paraffin-NBP2-33633-img0002.jpg)
Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - liver
![Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25177_MEF2BNB-Antibody-Immunohistochemistry-Paraffin-NBP2-33633-img0001.jpg)
Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
![Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25178_MEF2BNB%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33633-img0003.jpg)
Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-33633] - liver cancer