PLA2G4E Antibody
| Name | PLA2G4E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13767 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DAWNLSHTSEEFFHRWTREKVQDIEDEPILPEIPKCDANILETTVVIPGS WLSNSFREILTHRSFVSEFHNFLSGLQLHTNYLQNGQFSRWKD |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLA2G4E |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PLA2G4E Antibody [NBP2-13767] - Staining of human cell line U-251 MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24088_PLA2G4E%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13767-img0002.jpg)
Immunocytochemistry/Immunofluorescence: PLA2G4E Antibody [NBP2-13767] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: PLA2G4E Antibody [NBP2-13767] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24089_PLA2G4E%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13767-img0001.jpg)
Immunohistochemistry-Paraffin: PLA2G4E Antibody [NBP2-13767] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.