PPP1R11 Antibody

Name PPP1R11 Antibody
Supplier Novus Biologicals
Catalog NBP2-13798
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: AGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGR RSSKCCCIYEKPRAFG
Purity/Format Immunogen affinity purified
Blocking Peptide PPP1R11 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PPP1R11
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.