SCD-1 Antibody
| Name | SCD-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84749 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SCD-1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SCD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SCD-1 Antibody [NBP1-84749] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8805_SCD-1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84749-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SCD-1 Antibody [NBP1-84749] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
![Immunohistochemistry-Paraffin: SCD-1 Antibody [NBP1-84749] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8806_SCD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84749-img0002.jpg)
Immunohistochemistry-Paraffin: SCD-1 Antibody [NBP1-84749] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.