TTC9B Antibody
| Name | TTC9B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82042 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTC9B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TTC9B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TTC9B Antibody [NBP1-82042] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4495_TTC9B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82042-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TTC9B Antibody [NBP1-82042] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and mitochondria.
![Immunohistochemistry-Paraffin: TTC9B Antibody [NBP1-82042] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4496_TTC9B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-82042-img0002.jpg)
Immunohistochemistry-Paraffin: TTC9B Antibody [NBP1-82042] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.