ITPKA Antibody

Name	ITPKA Antibody
Supplier	Novus Biologicals
Catalog	NBP1-81590
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
Purity/Format	Immunogen affinity purified
Blocking Peptide	ITPKA Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	ITPKA
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: ITPKA Antibody [NBP1-81590] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human lateral ventricle shows positivity in astrocytes.

Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Staining of mouse hippocampus shows positivity in astrocytes.

Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Staining of mouse hypothalamus shows positivity in astrocyte end feet accentuated around blood vessels.

Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Staining of mouse subiculum shows immunoreactivity in astrocytes.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human cerebellum shows strong positivity in astroglia.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human cerebral cortex shows strong cytoplasmic positivity in subset of glial cells and neuropil.