Carbonic Anhydrase VIII/CA8 Antibody
| Name | Carbonic Anhydrase VIII/CA8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86654 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Carbonic Anhydrase VIII/CA8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CA8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in human cell line K562.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26041_Carbonic-Anhydrase-VIII-CA8-Antibody-Western-Blot-NBP1-86654-img0006.jpg)
Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in human cell line K562.
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26042_Carbonic-Anhydrase-VIII-CA8-Antibody-Immunohistochemistry-Paraffin-NBP1-86654-img0001.jpg)
Immunohistochemistry-Paraffin: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
![Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in mouse cerebellum tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26043_Carbonic%2520Anhydrase%2520VIII-CA8%2520Antibody-Western%2520Blot-NBP1-86654-img0007.jpg)
Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in mouse cerebellum tissue.