Jagged 2 Antibody
| Name | Jagged 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86337 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-F IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Jagged 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | JAG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/20844_Jagged%25202%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86337-img0004.jpg)
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.