CD39L4/ENTPD5 Antibody
| Name | CD39L4/ENTPD5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85751 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CD39L4/ENTPD5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ENTPD5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CD39L4/ENTPD5 Antibody [NBP1-85751] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17007_CD39L4-ENTPD5-Antibody-Western-Blot-NBP1-85751-img0005.jpg)
Western Blot: CD39L4/ENTPD5 Antibody [NBP1-85751] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
![Immunocytochemistry/Immunofluorescence: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human cell line U-251MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17008_CD39L4-ENTPD5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85751-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human cell line U-251MG shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17009_CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0004.jpg)
Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Simple Western lane view shows a specific band for CD39L4/ENTPD5 in 0.2 mg/ml of h. Liver lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17010_CD39L4-ENTPD5-Antibody-Simple-Western-NBP1-85751-img0006.jpg)
Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Simple Western lane view shows a specific band for CD39L4/ENTPD5 in 0.2 mg/ml of h. Liver lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Electropherogram image of the corresponding Simple Western lane view. CD39L4/ENTPD5 antibody was used at 1:25 dilution on h. Liver lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17011_CD39L4-ENTPD5-Antibody-Simple-Western-NBP1-85751-img0008.jpg)
Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Electropherogram image of the corresponding Simple Western lane view. CD39L4/ENTPD5 antibody was used at 1:25 dilution on h. Liver lysate(s) respectively.