ODF2L Antibody
| Name | ODF2L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82922 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLLPLFKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDNESENTNLKKKVFEKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ODF2L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ODF2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ODF2L Antibody [NBP1-82922] - Staining of human cell line U-2 OS shows positivity in nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4438_ODF2L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82922-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ODF2L Antibody [NBP1-82922] - Staining of human cell line U-2 OS shows positivity in nucleoli. Antibody staining is shown in green.
![Immunohistochemistry: ODF2L Antibody [NBP1-82922] - Staining of human breast shows moderate cytoplasmic and nuclear positivity combined with staining of luminal membranes in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4439_ODF2L-Antibody-Immunohistochemistry-NBP1-82922-img0003.jpg)
Immunohistochemistry: ODF2L Antibody [NBP1-82922] - Staining of human breast shows moderate cytoplasmic and nuclear positivity combined with staining of luminal membranes in glandular cells.