UQCRFS1 Antibody
| Name | UQCRFS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38623 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UQCRFS1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UQCRFS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RIP1 Antibody [NBP2-38623] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11717_RIP1%2520Antibody-Western%2520Blot-NBP2-38623-img0002.jpg)
Western Blot: RIP1 Antibody [NBP2-38623] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunohistochemistry: RIP1 Antibody [NBP2-38623] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11718_RIP1-Antibody-Immunohistochemistry-NBP2-38623-img0001.jpg)
Immunohistochemistry: RIP1 Antibody [NBP2-38623] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.