Cathepsin Z Antibody
| Name | Cathepsin Z Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38614 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Cathepsin Z Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CTSZ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cathepsin Z Antibody [NBP2-38614] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13261_Cathepsin-Z-Antibody-Western-Blot-NBP2-38614-img0005.jpg)
Western Blot: Cathepsin Z Antibody [NBP2-38614] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
![Immunocytochemistry/Immunofluorescence: Cathepsin Z Antibody [NBP2-38614] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13262_Cathepsin%2520Z%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38614-img0006.jpg)
Immunocytochemistry/Immunofluorescence: Cathepsin Z Antibody [NBP2-38614] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
![Immunohistochemistry: Cathepsin Z Antibody [NBP2-38614] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13263_Cathepsin-Z-Antibody-Immunohistochemistry-NBP2-38614-img0002.jpg)
Immunohistochemistry: Cathepsin Z Antibody [NBP2-38614] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
![Simple Western: Cathepsin Z Antibody [NBP2-38614] - Simple Western lane view shows a specific band for Cathepsin Z in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13264_Cathepsin-Z-Antibody-Simple-Western-NBP2-38614-img0003.jpg)
Simple Western: Cathepsin Z Antibody [NBP2-38614] - Simple Western lane view shows a specific band for Cathepsin Z in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
![Simple Western: Cathepsin Z Antibody [NBP2-38614] - Electropherogram image of the corresponding Simple Western lane view. Cathepsin Z antibody was used at 1:10 dilution on SW480 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13265_Cathepsin-Z-Antibody-Simple-Western-NBP2-38614-img0004.jpg)
Simple Western: Cathepsin Z Antibody [NBP2-38614] - Electropherogram image of the corresponding Simple Western lane view. Cathepsin Z antibody was used at 1:10 dilution on SW480 lysate(s) respectively.