CSE1L/CAS/Exportin-2 Antibody
| Name | CSE1L/CAS/Exportin-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38384 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CSE1L/CAS/Exportin-2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CSE1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody [NBP2-38384] - Staining of human cell line CACO-2 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9465_CSE1L-CAS-Exportin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38384-img0001.jpg)
Immunocytochemistry/Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody [NBP2-38384] - Staining of human cell line CACO-2 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
![Immunohistochemistry: CSE1L/CAS/Exportin-2 Antibody [NBP2-38384] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9466_CSE1L-CAS-Exportin-2-Antibody-Immunohistochemistry-NBP2-38384-img0002.jpg)
Immunohistochemistry: CSE1L/CAS/Exportin-2 Antibody [NBP2-38384] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.