TTC27 Antibody
| Name | TTC27 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38761 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCEFTPAPTPQEHLTKNLELNDDTILNDIKLADCEQFQMPDLCAEEIAIILGICTNFQKNNP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTC27 Protein |
| Description | Rabbit Polyclonal |
| Gene | TTC27 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TTC27 Antibody [NBP2-38761] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17931_TTC27-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38761-img0001.jpg)
Immunocytochemistry/Immunofluorescence: TTC27 Antibody [NBP2-38761] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
![Immunohistochemistry: TTC27 Antibody [NBP2-38761] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17932_TTC27%2520Antibody-Immunohistochemistry-NBP2-38761-img0002.jpg)
Immunohistochemistry: TTC27 Antibody [NBP2-38761] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.