LRP2 Antibody
| Name | LRP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39033 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRP2 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: LRP2 Antibody [NBP2-39033] - Immunofluorescent staining of human cell line HEK 293 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17751_LRP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39033-img0001.jpg)
![Immunohistochemistry: LRP2 Antibody [NBP2-39033] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1664_LRP2-Antibody-Immunohistochemistry-NBP2-39033-img0003.jpg)