UbcH5a/UBE2D1 Antibody (2C6)
| Name | UbcH5a/UBE2D1 Antibody (2C6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007321-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2C6 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | UBE2D1 (NP_003329, 1 a.a. - 94 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | UBE2D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6.Lane 1: UBE2D1 transfected lysate(16.6 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/16582_UbcH5a-UBE2D1%2520Antibody%2520(2C6)-Western%2520Blot-H00007321-M01-img0008.jpg)
Western Blot: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6.Lane 1: UBE2D1 transfected lysate(16.6 KDa).Lane 2: Non-transfected lysate.
![Immunohistochemistry-Paraffin: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Analysis of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. Antibody concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/16583_UbcH5a-UBE2D1-Antibody-(2C6)-Immunohistochemistry-Paraffin-H00007321-M01-img0006.jpg)
Immunohistochemistry-Paraffin: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Analysis of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. Antibody concentration 1 ug/ml.
![Sandwich ELISA: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/16584_UbcH5a-UBE2D1-Antibody-(2C6)-Sandwich-ELISA-H00007321-M01-img0007.jpg)
Sandwich ELISA: UbcH5a/UBE2D1 Antibody (2C6) [H00007321-M01] - Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3ng/ml as a capture antibody.