FGF-8 Antibody (2A10)
| Name | FGF-8 Antibody (2A10) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002253-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2A10 |
| Applications | WB ELISA |
| Species Reactivities | Human, Rat |
| Antigen | FGF8 (NP_149354 65 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | FGF8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11394_FGF-8-Antibody-(2A10)-Western-Blot-H00002253-M01-img0008.jpg)
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Jurkat.
![Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in PC-12.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11395_FGF-8-Antibody-(2A10)-Western-Blot-H00002253-M01-img0005.jpg)
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in PC-12.
![Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10 Analysis of FGF8 expression in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11396_FGF-8-Antibody-(2A10)-Western-Blot-H00002253-M01-img0006.jpg)
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10 Analysis of FGF8 expression in HepG2.
![Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Raw 264.7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11397_FGF-8-Antibody-(2A10)-Western-Blot-H00002253-M01-img0007.jpg)
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Raw 264.7.
![Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in NIH/3T3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11398_FGF-8%2520Antibody%2520(2A10)-Western%2520Blot-H00002253-M01-img0009.jpg)
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in NIH/3T3.
![Sandwich ELISA: FGF-8 Antibody (2A10) [H00002253-M01] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11399_FGF-8-Antibody-(2A10)-Sandwich-ELISA-H00002253-M01-img0004.jpg)
Sandwich ELISA: FGF-8 Antibody (2A10) [H00002253-M01] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.