beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody

Name beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59864
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to B4GALT2(UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQ
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene B4GALT2
Supplier Page Shop

Product images