Acetyl-coenzyme A transporter 1 Antibody

Name	Acetyl-coenzyme A transporter 1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-59882
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to SLC33A1(solute carrier family 33 (acetyl-CoA transporter), member 1) The peptide sequence was selected from the middle region of SLC33A1. Peptide sequence CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFF
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	SLC33A1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Antibody Titration: 1 ug/ml Human heart.

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.